PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 650aa    MW: 71696.9 Da    PI: 6.9139
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30449genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.95.4e-2489143156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               kpr++Wt+eL ++F+ea++q+ G +kA+Pk+ilelmkv+ Lt++ ++SHLQkYRl+
  EMT30449  89 KPRVVWTTELQNKFLEAIDQI-GLDKAVPKKILELMKVDYLTRDSIASHLQKYRLH 143
               79*******************.********************************97 PP

2Response_reg21.79.9e-095405752659
                   EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHH CS
  Response_reg  26 vaeaddgeealellkekd..pDlillDiempgmdGl 59 
                    +++ dg+ a ++l+  +  +Dl+++D++mpgmdG+
      EMT30449 540 STTVMDGKTASKMLRVGKeqFDLVITDVRMPGMDGF 575
                   46888999999999666556***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.855129IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23004.8E-6246No hitNo description
SuperFamilySSF466891.72E-1886146IPR009057Homeodomain-like
PROSITE profilePS5129410.57486145IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2688147IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2589143IPR006447Myb domain, plants
PfamPF002491.2E-591141IPR001005SANT/Myb domain
Gene3DG3DSA:3.40.50.23004.1E-7535576No hitNo description
SuperFamilySSF521729.96E-7537576IPR011006CheY-like superfamily
CDDcd001561.27E-6541575No hitNo description
PfamPF000727.4E-5541576IPR001789Signal transduction response regulator, receiver domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MKGITHGACD YLVKPVCTNE LKNIWQHVER RRNFEAKTHI NNNNNNDHDD DRVQPRTAAT  60
SKDSGNKGNE GYDSNENQEI THVSTTWKKP RVVWTTELQN KFLEAIDQIG LDKAVPKKIL  120
ELMKVDYLTR DSIASHLQKY RLHLRRVKPN PVGDASERHN SSYNNMNNQG SFMRNHEHEI  180
WCMSSGLLSP NNFSAMGHLA QPANTQRNSC MGSFIHDGRM YKYVAPKLSD AGTFAGSIDP  240
PANLYNNIPN ETTLDEFPSY SFGDSYAGCM RGKLVETNKG KFPDPSYNSA THATLTGVLH  300
RGIISPISSN VNVEVQNEMA TVIRNATSMA GFNEQIVPKN APSNQSFVGM LNACGSRPVS  360
SSEMVKGGSS SISVDGFSER MAPFNVAKNT SSVGMMLNEN TAPGNGRISM THTDMANSGR  420
TISTLSNHQT ENVVAITDKL DGGDAVSNHP MQVGTIGQHA LNDQFNDIKD FSWDDLFLNP  480
LDAIISSIAP ASGENNKNKT KTGPQTDMLT FDNGMKTKIG RFVEGNENRK GTKQQTSISS  540
TTVMDGKTAS KMLRVGKEQF DLVITDVRMP GMDGFKPRAH PPRDGYQEEG RRFGDEVDLI  600
TNWLSLTPNR GSAAYLYPGP TAAVQHLTPV DCGGDEDRDS EMPHHPTRYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2285147163ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8C8380.0M8C838_AEGTA; Two-component response regulator ARR10
STRINGMLOC_12999.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15285415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.15e-35response regulator 10